PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G23430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 425aa    MW: 44229.9 Da    PI: 9.1295
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G23430.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.14e-41182258177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++sg++qrfCqqCsrfh l+efDe+krsCr+rLa+hn+rrrk++
  OMERI06G23430.1 182 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAASGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHNRRRRKPA 258
                      6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.6E-35175244IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.547180257IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.81E-39181260IPR004333Transcription factor, SBP-box
PfamPF031104.2E-31183256IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MMSGRMNAAG DESPFPFGAM QAPGPGAYVG FDHGAAAVAA AAAAAQRAGM LQHHHHHMYD  60
GLDFAAAMQF GGGQDAPPHP QLLALPPSMA APPPPPMPMP LQMPMTMPMP GDVYPALGIV  120
KREGGGGGQD AAAAAGRIGL NLGRRTYFSP GDMLAVDRLL MRSRLGGVFG LGFGGAHHQP  180
PRCQAEGCKA DLSGAKHYHR RHKVCEYHAK ASVVAASGKQ QRFCQQCSRF HVLTEFDEAK  240
RSCRKRLAEH NRRRRKPAAT TAVAVAKDAA PVAAGKKPSG GAATSYTGDN KNVVSMSAAK  300
SPISSNTSVI SCLAEQGKHA AAAARPTALT LGGAPPQESS APQIGAMLHH HHHHQQDHMQ  360
VSSLVHINGG GGGGSNNILS CSSVCSSALP STATNGEVSD QNNDNSHNNG GSNNNNMHLF  420
EVDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-301832561184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1239256KRSCRKRLAEHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642406.10.0PREDICTED: squamosa promoter-binding-like protein 10
SwissprotA2YFT90.0SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE80.0SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLA0A0E0E4P60.0A0A0E0E4P6_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g44860.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA023408-PA0.0(Oryza sativa Indica Group)
STRINGORGLA06G0196600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-44squamosa promoter binding protein-like 8